SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018367 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018367
Domain Number 1 Region: 208-306
Classification Level Classification E-value
Superfamily PDZ domain-like 1.8e-19
Family PDZ domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018367   Gene: ENSGGOG00000023518   Transcript: ENSGGOT00000024887
Sequence length 388
Comment pep:novel chromosome:gorGor3.1:10:114531061:114534527:-1 gene:ENSGGOG00000023518 transcript:ENSGGOT00000024887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPQEQGSPASCFETSPAGHATQASPYHPRACRGGFYLLPVNGFPEEEDDGELRERLGALK
VSPSASAPRHPHKGIPPLQDVPVDAFTPLRIACTPPPQLPPVAPRPLRPNWLLTEPLSRE
HPPQSQIRGRAQSRSRSRSSRGQGKSPGRRSPSPVPTPAPSMANGRYHKPRKARPPLPRP
LDGEAAKVGAKQGPSENGTEGTAEEAAMKTTSGELKTVTLSKMKQSLGISISGGIESKVQ
PMVKIEKIFPGGAAFLSGALQAGFELVAVDGENLEQVTHQRAVDTIRRAYRNKAQEPMEL
VVRVPGPSPRPSPSDSSALTDGGLPADHLPAHQPLDAAPVPAHWLPEPPTNPQTPPTDAR
LLQPTPSPAPSPALQTPDSKPTPSPRIP
Download sequence
Identical sequences ENSGGOP00000018367 ENSGGOP00000018367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]