SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018383 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018383
Domain Number 1 Region: 4-85
Classification Level Classification E-value
Superfamily SPOC domain-like 8.83e-17
Family Ku70 subunit middle domain 0.0000302
Further Details:      
 
Domain Number 2 Region: 114-155
Classification Level Classification E-value
Superfamily SAP domain 0.0000201
Family SAP domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018383   Gene: ENSGGOG00000022207   Transcript: ENSGGOT00000034519
Sequence length 156
Comment pep:novel chromosome:gorGor3.1:8:60985224:60987029:-1 gene:ENSGGOG00000022207 transcript:ENSGGOT00000034519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPYTEKVMATPEQVDKMKAIVQKLRFTCRSDSFENPGLQQHFRNLEALALDLMETEQTVD
LTLPKVEAMNKSLDSLVVEFKELYPPDYNPEGKFTKRKHNNEDFGSKRPKMKYSEEELKA
NISKGMLGNFTVPMLKEAYGLKKQELLEVLSEHFQA
Download sequence
Identical sequences ENSGGOP00000018383 ENSGGOP00000018383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]