SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018417 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018417
Domain Number 1 Region: 398-508
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 221-332
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-20
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 3 Region: 515-580
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000103
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 46-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000458
Family Spermadhesin, CUB domain 0.0054
Further Details:      
 
Domain Number 5 Region: 574-636
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000005
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 642-701
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000852
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 160-218
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000012
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 8 Region: 337-401
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000675
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018417   Gene: ENSGGOG00000004972   Transcript: ENSGGOT00000022776
Sequence length 783
Comment pep:known_by_projection chromosome:gorGor3.1:22:10330301:10417873:1 gene:ENSGGOG00000004972 transcript:ENSGGOT00000022776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLPQRPEPGEPGPDMAQEAPQEDTSPMALMDKGENELTGSASEESQALCSVSFSNPEGYI
DSSDYPLLPLNNFLECTYNVTVYTGYGVELQVKSVNLSDGELLSIRGVDGPTLTVLANQT
LLVEGQVIRSPTNTISVYFRTFQDDGLGTFQLHYQAFMLSCNFPRRPDSGDVTVMDLHSG
GVAHFHCHLGYELQGAKMLTCINASKPHWSSQEPICSGSAPCGGAVHNATIGRVLSPSYP
ENTNGSQFCVWTIEAPEGQKLHLHFERLLLHDKDRMTVHSGQTNKSALLYDSLQTESVPF
EGLLSEGNTIRIEFTSDQARAASTFNIRFEAFEKGHCYEPYIQNGNFTTSDPTYNIGTIV
EFTCDPGHSLEQGPAIIECINVRDPYWNDTEPLCRAMCGGELSAVAGVVLSPNWPEPYVE
GEDCIWKIHVGEEKRIFLDIQFLNLSNSDILTIYDGDEVMPHILGQYLGNSGPQKLYSST
PDLTIQFHSDPAGLIFGKGQGFIMNYIEVSRNDSCSDLPEIQNGWKTTSHTELVRGARIT
YQCDPGYDIVGSDTLTCQWDLSWSSDPPFCEKIMYCTDPGEVDHSTRLISDPVLLVGTTI
QYTCNPGFVLEGSSLLTCYSRETGTPIWTSRLPHCVSEESLACDNPGLPENGYQILYKRL
YLPGESLTFMCYEGFELMGEVTIRCILGQPSHWNGPLPVCKVAEAAAETSLEGGNMALAI
FIPVLIISLLLGGAYIYITRCRYYSNLRLPLMYSHPYSQITVETEFDNPIYETGETREYE
VSI
Download sequence
Identical sequences ENSGGOP00000018417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]