SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018427 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018427
Domain Number 1 Region: 43-91
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000193
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000018427
Domain Number - Region: 1261-1269
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.034
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018427   Gene: ENSGGOG00000014885   Transcript: ENSGGOT00000024061
Sequence length 1431
Comment pep:known_by_projection chromosome:gorGor3.1:12:43787928:43859449:-1 gene:ENSGGOG00000014885 transcript:ENSGGOT00000024061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QREMKKKTVCTLNMGDKKYEDMEGEENGDNTISTGLLYSEADRCPICLNCLLEKEVGFPE
SCNHVFCMTCILKWAETLASCPIDRKPFQAVFKFSALEGYVKVQVKKQLRETKDKKNENS
FEKQVSCHENSKSCIRRKAIVREDLLSAKVCDLKWIHRNSLYSETGGKKNAAIKINKPQR
SNWSTNQCFRNFFSNMFSSVSHSGESSFTYRAYCTEFIEASEISALIRQKRHELELSWFP
DTLPGIGRIGFIPWNVETEVLPLISSVLPRTIFPTSTISFEHFGTSCKGYALAHTQEGEE
KKQTSGTSNTRGSRRKPAMTTPTRRSTRNTRAETASQSQRSPISDNSGCDAPGNSNPSLS
VPSSAESEKQTRQAPKRKSVRRGRKPPLLKKKLRSSVAAPEKSSSNDSVDEETAESDTSP
VLEKEHQPDVDSSNICTVQTHVENQSANCLKSCNEQIEESEKHTANYDTEERVESSSSES
CAQDLPVLVSEEGEVKKLENTGIEANVLCLESKISENILEKGGDPLEKQDQISGLSQSEV
KTDICTVHLPNDFPTCLTSESKVYQPVSCPLSELSENVESVVNEEKMTESSIVEITEHKD
FTLKTEELIESPKLESSEGEIIQTVDRQSVKSPEVQLLGHVETEDVEIIATCDTFGNEDF
NNIQDSENNLLKNNLLNTKLEKSLEEKNESLTEHPRSTELPKTHIEQIQKHFSEDNNEMI
PMECDSFCSDQNESEVEPSVNADLKQMNENSVTHRSENNMPSSDLADEKVETVSQPSESP
KDTIDKAKKPRTRRSRFHSPSTTWSPNKDTPQEKKRPQSPSPRRETGKESRKSQSPSPKN
ESARGRKKSRSQSPKKDIARERRQSQSRSPKRDTTRESRRSESLSPSRETSRENKRSQPR
VKDSSPGEKSRSQSRERESDRDVQRRERERRTRKWSRSRSHSRSPSRCRTKSKSSSFGRI
DRDSYFPRWKGRWVNDGWRCPRGNDRFRKNDPEKQNENTRKEKNDIHLDADDPNSADKHR
NDCPNWITEKINSGPDPRTRNPEKLKESHWEENRNENSGNSWNKNFGSGWVSNRGRGRGN
RGRGTYRSSFAYKDQNENRWQNRKPLSGSESFKFVEQQSYKRKSEQEFSFDTPADRSGWT
SASSWAVRKTLPADVQNYYSRRGRNSSGPQSGWMKQEEETSGQDSSLKDQTNQQVDGSQL
PINMMQPQMNVMQQQPVGVHAPLMNIQRNPFNIHPQLPLHLHTGVPLMQVATPTSVSQGL
PPPPPPPPPSQQVNYIASQPDGKQLQGIPSSSHVSNNMSTPVLPAPTAAPGNTGMVQGPS
SGNTSSSSHSKASNAAVKLAESKKLQIQEKAAQEVKLAIKPFYQNKDITKEEYKEIVRKA
VDKVCHSKSGEVNSTKVANLVKAYVDKYKYSRKGSQKKTLEEPVSTEKNIG
Download sequence
Identical sequences ENSGGOP00000018427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]