SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018435 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018435
Domain Number 1 Region: 75-234
Classification Level Classification E-value
Superfamily EF-hand 3.23e-27
Family Calmodulin-like 0.027
Further Details:      
 
Domain Number 2 Region: 204-306
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000546
Family Calmodulin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018435   Gene: ENSGGOG00000025038   Transcript: ENSGGOT00000022839
Sequence length 331
Comment pep:known_by_projection chromosome:gorGor3.1:11:32583008:32597807:1 gene:ENSGGOG00000025038 transcript:ENSGGOT00000022839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDH
EAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNV
AKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADL
NGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGP
EPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKL
TKEEILENWNMFVGSQATNYGEDLTKNHDEL
Download sequence
Identical sequences G3RRL1 K7BDK0 Q15293 V9HW95
ENSP00000054950 9606.ENSP00000054950 gi|4506455|ref|NP_002892.1| NP_002892.1.87134 NP_002892.1.92137 XP_004050937.1.27298 XP_016776119.1.37143 ENSGGOP00000018435 ENSP00000054950 ENSP00000054950 ENSGGOP00000018435 NYSGRC-4506455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]