SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018462 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018462
Domain Number 1 Region: 253-481
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-20
Family Laminin G-like module 0.093
Further Details:      
 
Domain Number 2 Region: 76-158
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000127
Family Cadherin 0.0051
Further Details:      
 
Domain Number 3 Region: 25-83
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000485
Family Cadherin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018462   Gene: ENSGGOG00000007929   Transcript: ENSGGOT00000031611
Sequence length 909
Comment pep:known_by_projection chromosome:gorGor3.1:3:140639398:140782023:1 gene:ENSGGOG00000007929 transcript:ENSGGOT00000031611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEICAFKIHGQELPFEAVVLNKTSGEGRLRAKSPIDCELQKEYTFIIQAYDCGAGPHETA
WKKSHKAVVHIQVKDVNEFAPTFKEPAYKAVVTEGKIYDSILQVEAVDEDCSPQYSQICN
YEIVTTDVPFAIDRNVWLKTKKKITMSSSHHLPLGVSVYVCSDFHTSVDFLLRLAINIPV
SPWWLHWTKRIEYQPGSGSMPLFPSIHLETCDGAVSSLQIIAELQTNYIGKGCDRETYSE
KSLQKLCGASSGIIDLLPSPSAATNWTAGLLVDSSEMIFKFDGRQGAKIPDGIVPKNLTD
QFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDFDQADTF
RPAEFHWKLDQICDKEWHYYVINVEFPVVTLYMDGATYEPYLVTNDWPIHPSHIAMQLTV
GACWQAMQGSESENALKMGTDLASGIQNHVCKHFFHGSLASLTIRPGKMESQKVISCLQA
CKEGLDINSLESLGQGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINSRQFPTAGVRR
LKVSSKVQCFGEDVCISIPEVDAYVMVLQAIEPRITLRGTDHFWRPAAQFESARGVTLFP
DIKIVSTFAKTEAPGDQPSQDPCLHPKSEVLEEMLHNLDFCDILVIGGDLDPRQECLELN
HSELHQRHLDATNSTAGYSIYGVGSMSRYEQVLHHIRYRNWRPASLEARRFRIKCSELNG
RYTSNEFNLEVSILHEDRVSDKEHVNHLIVQPPFLQSVHHPESRSSIQRSSASHASFFLV
PVVPSIATVVIIISVCMLVFVVAMGVYRVRIAHQHFIQETEAAKESEMDWDDSALTITVN
PMEKHEGPGHGEDETEGEEEEEAEEETSSSSGSDDSEEEEDEEGMGRGRHGQNGARQAQL
EWDDSTLPY
Download sequence
Identical sequences ENSGGOP00000018462 ENSGGOP00000018462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]