SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018472 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018472
Domain Number 1 Region: 9-171
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 1.83e-42
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018472   Gene: ENSGGOG00000006243   Transcript: ENSGGOT00000027048
Sequence length 189
Comment pep:known_by_projection chromosome:gorGor3.1:15:79025092:79062335:-1 gene:ENSGGOG00000006243 transcript:ENSGGOT00000027048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELSKLGLGNETVVQLRTLELPVDYREAKRRVTGIWEDHQPQLVVHVGMDTAAKAIILEQS
GKNQGYRDADIRGFWPEGGVCLPGSPDVLESGVCMKAVCKRVAVEGVDVIFSRDAGRYVC
DYTYYLSLHHGKGCAALIHVPPLSRGLPASLLGRALKVVIQEMLEEVGKPKHKAQFEENS
TMVLPAKGN
Download sequence
Identical sequences ENSGGOP00000018472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]