SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018562 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018562
Domain Number 1 Region: 76-213
Classification Level Classification E-value
Superfamily C-type lectin-like 1.07e-34
Family C-type lectin domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018562   Gene: ENSGGOG00000027919   Transcript: ENSGGOT00000023476
Sequence length 214
Comment pep:known_by_projection chromosome:gorGor3.1:7:137831215:137851718:1 gene:ENSGGOG00000027919 transcript:ENSGGOT00000023476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAREPPSRARPPPPLAARPAPAPAAPRPRSPAEAEARGPEGLLRRSGSGYEGSTSWKA
ALEDTTTRLLLGAIAVLLFAILVVMSILASKGCIKCEAPCPEDWLLYGRKCYFFSEEPRD
WNTGRQYCHTHEAVLAVIQSQKELEFMFKFTRREPWIGLRRVGDEFHWVNGDPFDPDTFT
IAGPGECVFVEPTRLVSTECLMTRPWVCSKMAYT
Download sequence
Identical sequences G3RRY7 H2RIE9 P0C7M8
9606.ENSP00000390661 ENSPTRP00000061307 ENSP00000390661 ENSGGOP00000018562 gi|168229214|ref|NP_001073980.2| ENSP00000390661 ENSPTRP00000061307 NP_001073980.2.87134 NP_001073980.2.92137 XP_003318880.1.37143 XP_004046358.1.27298 ENSP00000390661 ENSGGOP00000018562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]