SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018574 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018574
Domain Number 1 Region: 25-57,109-172
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-23
Family Voltage-gated potassium channels 0.0053
Further Details:      
 
Domain Number 2 Region: 181-293
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-20
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018574   Gene: ENSGGOG00000001329   Transcript: ENSGGOT00000027305
Sequence length 418
Comment pep:known_by_projection chromosome:gorGor3.1:11:61102871:61111468:1 gene:ENSGGOG00000001329 transcript:ENSGGOT00000027305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTAPQEPPARPLQAGSGAGLAPGRAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQA
QRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSAWDLGSAFF
FSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEA
IFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGF
GDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQA
ASWTGTVTARVTQRAGPAAPPPEKEQPLLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTAS
ALDYPSENLAFIDESSDTQSERGCPLPRAPRGRRRPNPPRKPVRPRGPGRPRDKGVPV
Download sequence
Identical sequences ENSGGOP00000018574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]