SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018583 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018583
Domain Number 1 Region: 367-450
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.25e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0000073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018583   Gene: ENSGGOG00000012135   Transcript: ENSGGOT00000028336
Sequence length 454
Comment pep:known_by_projection chromosome:gorGor3.1:8:127530492:127535896:1 gene:ENSGGOG00000012135 transcript:ENSGGOT00000028336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDFFRIVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP
SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSPRGDNDGGGGSFSTADQLEMVTEL
LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSLNPA
RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS
STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSVG
GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
RSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS
VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
Download sequence
Identical sequences G3RS08
ENSGGOP00000018583 ENSGGOP00000018583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]