SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018585 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018585
Domain Number 1 Region: 130-510
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.7e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000271
Further Details:      
 
Domain Number 2 Region: 487-612
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.63e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000242
Further Details:      
 
Domain Number 3 Region: 29-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.84e-16
Family Thioltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018585   Gene: ENSGGOG00000012754   Transcript: ENSGGOT00000034556
Sequence length 617
Comment pep:known_by_projection chromosome:gorGor3.1:12:103630850:103737063:1 gene:ENSGGOG00000012754 transcript:ENSGGOT00000034556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKDHHPGKTLPENPAGFTSTATADSRALLQAYIDGHSVVIFSRSTCTRCTEVKKLFKSLC
VPYFVLELDQTEDGRALEGTLSELAAETDLPVVFVKQRKIGGYGPTLKAYQEGRLQKLLK
MNGPEDLPESYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCV
NVGCIPKKLMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRVAL
REKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISS
DDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHM
EEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVRNGPRKQITCLLD
ISITYDIKICFGTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAG
STVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNK
CYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFT
TLSVTKRSGASILQAGC
Download sequence
Identical sequences ENSGGOP00000018585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]