SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018618 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018618
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.45e-30
Family Galectin (animal S-lectin) 0.00061
Further Details:      
 
Domain Number 2 Region: 182-253
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-22
Family Galectin (animal S-lectin) 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018618   Gene: ENSGGOG00000000818   Transcript: ENSGGOT00000030177
Sequence length 256
Comment pep:novel chromosome:gorGor3.1:5:56620733:56627543:-1 gene:ENSGGOG00000000818 transcript:ENSGGOT00000030177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPGPRFAVNFQTSFSGNGIAFHFNLLFEEGGYMVYNRRQKGRWGPEERKMHIPQQGMPFD
LCFLLQSSDFKVMVNGSLFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFS
TVLFSQPVCFPPRPRGRRQKPPGVWPANLAPVTQTVIHTVQSASGQMFSTPAIPPMMYPH
PAYPTPFVTIIPGGLYPSKSIILLGTVLPSAQRFHINPHSGNHIAFHLNPRFDENAVVHN
TQINNSWGSDERGTAG
Download sequence
Identical sequences ENSGGOP00000018618 ENSGGOP00000018618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]