SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018624 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000018624
Domain Number - Region: 117-265
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00228
Family YVTN repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018624   Gene: ENSGGOG00000025839   Transcript: ENSGGOT00000027439
Sequence length 272
Comment pep:novel chromosome:gorGor3.1:11:5479367:5517709:-1 gene:ENSGGOG00000025839 transcript:ENSGGOT00000027439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPPPPTSCAHGGLQEVSKPLVVQLTRRGFSYKAGAWGRDSAPNPASSLYWVAPLCTDGR
YFDYYRLYKSYNDLTLLKNYEERKMGYGDGSGNVVYKNFMYFNYCGTSDMAKMDLSSNTL
VLWRLPPGATYNNRFSYAGVPWQDLDFAGDEKGLWVLYATEESKGNLVVSHLNASTLEVE
KTWRTSQYKPALSGAFMACGVLYALHSLNTHQEEIFYAFDTTTGQERRLSILLDKMLEKL
QGINYCPSDHKLYVFNDGYLINYDLTFLTMKT
Download sequence
Identical sequences ENSGGOP00000018624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]