SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018677 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018677
Domain Number 1 Region: 32-335,389-607
Classification Level Classification E-value
Superfamily SNF-like 1.44e-153
Family SNF-like 0.0000597
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018677   Gene: ENSGGOG00000007544   Transcript: ENSGGOT00000023320
Sequence length 635
Comment pep:known_by_projection chromosome:gorGor3.1:17:92958592:92979859:-1 gene:ENSGGOG00000007544 transcript:ENSGGOT00000023320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRLVLPNPGLDARIPSLAELETIEQEEASSRPKWDNKAQYMLTCLGFCVGLGNVWRFPY
LCQSHGGGAFMIPFLILLVLEGIPLLHLEFAIGQRLRRGSLGVWSSIHPALKGLGLASML
TSFIVGLYYNTIISWIMWYLFNSFQEPLPWSECPLNENQTGYVDECARSSPVDYFWYRET
LNISTSISDSGSIQWWLLLCLACAWSVLYMCTIRGIETTGKVVYITSTLPYVVLTIFLIR
GLTLKGATNGIVFLFTPNVTELVQPDTWLDAGAQVFFSFSLAFGGLISFSSYNSVHNNCE
KDSVIVSIINGFTSVYVAIVVYSVIGFRATQRYDDCFSTNILTLINGFDLPEGNVTQENF
VDMQRQCNASDPAAYAQLVFQTCDINSFLSEAVEGTGLAFIIFTEAITKMPLSPLWSVLF
FIMLFCLGLSSMFGNMEGVVVPLQDLRVIPPKWPKEVLTGLICLGTFLIGFIFTLNSGQY
WLSLLDSYAGSIPLLIIAFCEMFSVVYVYGVDRRFCGDHGYPPGHRRPGTGRVGKRVVSP
LLMLIIFLFFFVVEVTQELSYSVWDPGYEEFPKSQKISYPNWVYVVVVIVAGVPSLTIPG
YAIYKLIRNHCQKPGDHQGLVSTLSTASMNGDLKY
Download sequence
Identical sequences ENSGGOP00000018677 ENSGGOP00000007387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]