SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018680 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018680
Domain Number 1 Region: 824-932
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-22
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 2 Region: 29-161
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8e-18
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 294-414
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.04e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 4 Region: 256-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000391
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 640-800
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000023
Family Growth factor receptor domain 0.0078
Further Details:      
 
Domain Number 6 Region: 159-294
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000251
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018680   Gene: ENSGGOG00000016378   Transcript: ENSGGOT00000029905
Sequence length 1009
Comment pep:known_by_projection chromosome:gorGor3.1:6:36199594:36235986:1 gene:ENSGGOG00000016378 transcript:ENSGGOT00000029905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGRVPGLCLLVLLVHARAAQYSKAAQDVDECVEGTDNCHIDAICQNTPRSYKCICKSG
YTGDGKHCKDVDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGN
GGCQQSCVNMMGSYECHCREGFFLSDNQHTCIQRPEEGMNCMNKNHGCAHICRETPKGGI
ACECRPGFELTKNQRDCKLTCNYGNGGCQHTCDDTEQGPRCGCHIKFVLHTDGKTCIGER
RLEQHIPTQAVSNETCAVNNGGCDSKCHDAATGVHCTCPVGFMLQPDRKTCKDIDECRLN
NGGCDHICRNTVGSFECSCKKGYKLLINERNCQDIDECSFDRTCDHICVNTPGSFQCLCH
RGYLLYGITHCGDVDECSINRGGCRFGCINTPGSYQCTCPAGHGRLHWNGKDCTEPLKCQ
GSPGASKAMLSCNRSGKKDTCALTCPSRARFLPESENGFTVSCGTPSPRAAPARAGHNGN
STNSNHCHEAAVLSIKQRASFKIKDAKCRLHLRNKGKTEEAGRITGPGGAPCSECQVTFI
HLKCDSSRKGKGRRARTPPGKEVTRLTLELEAEVRAEETTASCGLPCLRQRMERRLKGSL
KMLRKSINQDRFLLRLAGLDYELAHKPGLVAGERAEPMESCRPGQHRAGTKCVSCPQGTY
YHGQTEQCVPCPAGTFQEREGQLSCDLCPGSDAHGPLGATNVTTCAGQCPPGQHSVDGFK
PCQPCPRGTYQPEAGRTLCFPCGGGLTTKHEGAISFQDCDTKVQCSPGHYYNTSIHRCIR
CAMGSYQPDFRQNFCSRCPGNTSTDFDGSTSVAQCKNRQCGGELGEFTGYIESPNYPGNY
PAGVECIWNINPPPKRKILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERP
IAFTARSRKLWINFKTSEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILK
DKKLIKAFFEVLAHPQNYFKYTEKHKEMLPKSFIKLLRSKVSSFLRPYK
Download sequence
Identical sequences ENSGGOP00000018680 ENSGGOP00000015991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]