SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018686 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018686
Domain Number 1 Region: 149-255
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000327
Family cAMP-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018686   Gene: ENSGGOG00000026505   Transcript: ENSGGOT00000024891
Sequence length 360
Comment pep:known_by_projection chromosome:gorGor3.1:6:105135049:105175850:-1 gene:ENSGGOG00000026505 transcript:ENSGGOT00000024891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYTESSPLRESTAIGFTPELESIIPVPSNKTTCENWREIHHLVFHVANICFAVGLVIPT
TLHLHMIFLRGMLTLGCTLYIVWATLYRCALDIMIWNSVFLGVNILHLSYLLYKKRPVKI
EKELSGIYRRLFEPLRVPPDLFRRLTGQFCMIQTLKKGQTYAAEDKTSVDDRLSILLKGK
MKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIIADDNCRFLCWSRERLTYFLE
SEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS
DSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP
Download sequence
Identical sequences ENSGGOP00000018686 XP_004044508.1.27298 ENSGGOP00000018686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]