SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018775 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018775
Domain Number 1 Region: 86-145
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.83e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018775   Gene: ENSGGOG00000004311   Transcript: ENSGGOT00000027206
Sequence length 206
Comment pep:known_by_projection chromosome:gorGor3.1:5:138465246:138468285:-1 gene:ENSGGOG00000004311 transcript:ENSGGOT00000027206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAAA
TAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTK
LSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQHHEGFPP
ALGPVEKRIKGRTGWPQQVWALELNQ
Download sequence
Identical sequences ENSGGOP00000018775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]