SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018815 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018815
Domain Number 1 Region: 473-541
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000785
Family HLH, helix-loop-helix DNA-binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018815   Gene: ENSGGOG00000008166   Transcript: ENSGGOT00000033309
Sequence length 587
Comment pep:known_by_projection chromosome:gorGor3.1:15:36275999:36373636:1 gene:ENSGGOG00000008166 transcript:ENSGGOT00000033309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRNVGAKFCQSSLLRQDLGLGSPAQLSSSGKPGTAYYSFSATSSRRRPLHDSAALADPLQ
AKKVRKVPPGLPSSVYAPSPNSDDFNRESPSYPSPKPPTSMFASTFFMQDGTHNSSDLWS
SSNGMSQPGFGGILGTSTSHMSQSSSYGNLHSHDRLSYPPHSVSPTDINTSLPPMSSFHR
SSTSSSPYVAASHTPPINGSDSILGARGNAAGSSQTGDALGKALASIYSPDHTSSSFPSN
PSTPVGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLKNRVEQQLHEHLQDAMSFLKDVC
EQSRMEDRLDRLDDAIHVLRNHAVGPSTSLPAGHSDIHSLLGPSHNAPIGSLNSNYGGSS
LVASSRSTSMVGTHREDSVSLNGNHSVLSSTVTTSSTDLNHKTQENYRGGLQSQSGTVVT
TEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSSRGRTSSTNEDEDLNPEQKIERE
KERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVR
ERNLNPKAACLKRREEEKVSAVSAEPPTTLPGTHPGLSETTNPMGHM
Download sequence
Identical sequences ENSGGOP00000018815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]