SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018817 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018817
Domain Number 1 Region: 128-218
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.71e-36
Family alpha-Amylases, C-terminal beta-sheet domain 0.00000275
Further Details:      
 
Domain Number 2 Region: 2-122
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.29e-30
Family Amylase, catalytic domain 0.000000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018817   Gene: ENSGGOG00000023540   Transcript: ENSGGOT00000030027
Sequence length 219
Comment pep:novel chromosome:gorGor3.1:1:106358737:106363102:1 gene:ENSGGOG00000023540 transcript:ENSGGOT00000030027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTR
VMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNF
RNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDK
INGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Download sequence
Identical sequences ENSGGOP00000018817 ENSGGOP00000018817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]