SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018849 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018849
Domain Number 1 Region: 75-132
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.96e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018849   Gene: ENSGGOG00000015736   Transcript: ENSGGOT00000026832
Sequence length 133
Comment pep:known_by_projection chromosome:gorGor3.1:1:139426745:139432515:1 gene:ENSGGOG00000015736 transcript:ENSGGOT00000026832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQH
LSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLA
ICYISYLNHVLDV
Download sequence
Identical sequences A0A2I3SYL7 A0A2K5C383 A0A2K5PIB8 A0A2K6SEC2 G1RTD2 G3RI63 H0X316 Q02575 Q5T203
9598.ENSPTRP00000002602 9606.ENSP00000302189 ENSOGAP00000009481 ENSGGOP00000015352 ENSOGAP00000009481 gi|5031943|ref|NP_005589.1| ENSNLEP00000016506 ENSPTRP00000002602 ENSP00000302189 ENSGGOP00000018849 ENSPTRP00000002602 NP_005589.1.87134 NP_005589.1.92137 XP_001171930.1.37143 XP_003258759.1.23891 XP_003795235.1.62490 XP_003811937.1.60992 XP_003937989.1.74449 XP_004027759.1.27298 XP_006861714.1.41390 XP_009433913.1.37143 XP_012305088.1.9421 XP_017359096.1.71028 ENSP00000302189 ENSP00000302189 ENSNLEP00000016506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]