SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018852 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018852
Domain Number 1 Region: 279-456
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-64
Family SPRY domain 0.00000555
Further Details:      
 
Domain Number 2 Region: 9-81
Classification Level Classification E-value
Superfamily RING/U-box 7.07e-22
Family RING finger domain, C3HC4 0.0074
Further Details:      
 
Domain Number 3 Region: 82-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000275
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018852   Gene: ENSGGOG00000016890   Transcript: ENSGGOT00000024823
Sequence length 468
Comment pep:known_by_projection chromosome:gorGor3.1:1:208609229:208622392:-1 gene:ENSGGOG00000016890 transcript:ENSGGOT00000024823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELS
PQRNLRPNRPLAKMAEMARRLHPPSPVPQGVCPAHREPLAAFCGDELRLLCAACERSGEH
WAHRVRPLQDAAEDLKAKLEKSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLG
EFERLRRLLAEEEQQLLQRLEEEELEVLPRLREGAARLGQQSAHLAELIAELEGRCQLPA
LGLLQDTWVLPSRVQDVKLQPPEVVPMELRTVCRVPGLVETLRRFRGDVTLDPDTANPEL
ILSEDRRSVQRGDLRQSLPDSPERFDPGPCVLGQERFTSGRHYWEVEVGDRTSWALGVCR
ENVNRKEKGELSAGNGFWILVFLGSYYNSSERALAPLRDPPRRVGIFLDYEAGHLSFYSA
TDGSLLFIFPEIPFSGTLRPLFSPLSSSPTPMTICRPKGGSGDTLAPQ
Download sequence
Identical sequences ENSGGOP00000016479 ENSGGOP00000018852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]