SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018853 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018853
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily EF-hand 4.15e-17
Family Parvalbumin 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018853   Gene: ENSGGOG00000009478   Transcript: ENSGGOT00000022519
Sequence length 75
Comment pep:known_by_projection chromosome:gorGor3.1:22:21123520:21125094:-1 gene:ENSGGOG00000009478 transcript:ENSGGOT00000022519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEEDELGASPQARDLSAKETKML
MAAGDKDGDGKIGVD
Download sequence
Identical sequences ENSGGOP00000018853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]