SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018867 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018867
Domain Number 1 Region: 5-202
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.11e-23
Family MraW-like putative methyltransferases 0.069
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000018867
Domain Number - Region: 218-235
Classification Level Classification E-value
Superfamily SOCS box-like 0.034
Family SOCS box-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018867   Gene: ENSGGOG00000024428   Transcript: ENSGGOT00000029241
Sequence length 238
Comment pep:novel chromosome:gorGor3.1:1:125636981:125637812:1 gene:ENSGGOG00000024428 transcript:ENSGGOT00000029241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPFGINHGIELHSDVVEYAKEKLESFIKNSDSFDKFECCEPAFVVGNCLQIASDSHQYDR
IYCGAGVQKDHENYMKILLKVGGILVMPIGDQLTQIMRTGQNTWESKNILAVSFAPLVQP
SKNDNGKPDSVGLSPCAVRNLQDLARIYIRRTLRNFINDEMQAKGIPQRAPPKRKRKRVK
QRINTYVFVGNQLIPQPLDNHNEAMKPEEPPQNLLREKIMKLPLPESLKAYLTYFRDK
Download sequence
Identical sequences ENSGGOP00000018867 ENSGGOP00000018867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]