SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018963 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018963
Domain Number 1 Region: 198-398
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.29e-61
Family Reprolysin-like 0.0000255
Further Details:      
 
Domain Number 2 Region: 417-491
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 3.14e-19
Family Blood coagulation inhibitor (disintegrin) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018963   Gene: ENSGGOG00000014544   Transcript: ENSGGOT00000026178
Sequence length 824
Comment pep:known_by_projection chromosome:gorGor3.1:10:147269460:147284214:-1 gene:ENSGGOG00000014544 transcript:ENSGGOT00000026178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLGLWLLGAMMLPAIAPSRPWALVEQYEVVLPRRLPGPRVRRALPSHLGLHPERVSYV
LGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGYPDSAAS
LSTCAGLRGFFQVGSDLHLIEPLDEGGEGGRHAVYQAEHLLQTAGTCGVSDDSLGSLLGP
RTAAVFRPRPGDSLPSRETRYVELYVVVDNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKL
NFRVVLVGLEIWNSRDRFHVSPDPSVTLENLLTWQARQRTRRHLHDNVQLITGVDFTGTT
VGFARVSAMCSHSSGAVNQDHSKNPVGVACTIAHEMGHNLGMDHDENVQGCRCRERFEAG
RCIMAGSIGSSFPRMFSDCSEAYLESFLEQPQSACLANAPDLSHLVGGPVCGNLFVEHGE
QCDCGPPEDCQNRCCNSTTCQLAEGAQCAHGTCCQECKVKPAGELCRPKKDMCDLEEFCD
GRHPQCPEDAFQENGTPCSGGYCYNGACPTLAQQCQAFWGPGGQAAEESCFSYDILPGCK
ANRYRADTCGVLQCKGGQQPLGRAICIVDVCHALTTEDGTAYEPVPEGTRCGPEKVCWKG
RCQDLHVYRSSNCSAQCHNHGVCNHKQECHCHAGWAPPHCAKLLTEVHAASGSLPVFVVV
VLVLLAVVLVTLAGIIIYRKARSRILSRNVAPKTTMGRSNPLFHQAASRVPAKSGAPAPS
RGPQELVPTTHLGQPAGHPASSVALKRPPPAPPVTVSSPPFPVPVYTRQAPKQVIKPTFA
PPVPPVKPGAGAANPGPAEGAVGPKVALKPPIQRKQGAGAPTAP
Download sequence
Identical sequences G3RT38
XP_004050352.1.27298 ENSGGOP00000018963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]