SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018980 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018980
Domain Number 1 Region: 22-194
Classification Level Classification E-value
Superfamily Lysozyme-like 5.96e-18
Family G-type lysozyme 0.0000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018980   Gene: ENSGGOG00000022626   Transcript: ENSGGOT00000032995
Sequence length 194
Comment pep:known_by_projection chromosome:gorGor3.1:2a:96686402:96707656:-1 gene:ENSGGOG00000022626 transcript:ENSGGOT00000032995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALWLLLGLLALMDLSESSNWGCYGNIQTLDTPGASRGIGRRHGLNYCGVHASERLAEI
DMPYLLKYQPMMQTIGQKYCVDPAMIAGVLSRKSPGDKILVNVGDRTSMVQDPGSHAPTS
WISESQVSQTTEVLTTRIKEIQRRFPTWTSDQYLRGGLCAYSGGAGYVRSSQDLSCDFCN
GVLARAKYLKRHGF
Download sequence
Identical sequences G3RT55
ENSGGOP00000018980 ENSGGOP00000018980 XP_004031540.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]