SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018981 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018981
Domain Number 1 Region: 57-182,296-389,786-1036
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 9.29e-117
Family Calcium ATPase, transmembrane domain M 0.0013
Further Details:      
 
Domain Number 2 Region: 404-616
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 7.52e-68
Family Metal cation-transporting ATPase, ATP-binding domain N 0.000000104
Further Details:      
 
Domain Number 3 Region: 611-785
Classification Level Classification E-value
Superfamily HAD-like 1.81e-42
Family Meta-cation ATPase, catalytic domain P 0.0000592
Further Details:      
 
Domain Number 4 Region: 181-294
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.57e-25
Family Calcium ATPase, transduction domain A 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018981   Gene: ENSGGOG00000001316   Transcript: ENSGGOT00000025378
Sequence length 1045
Comment pep:known_by_projection chromosome:gorGor3.1:13:6460128:6492494:1 gene:ENSGGOG00000001316 transcript:ENSGGOT00000025378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQKTPEIYSVELSGTKDIVKTDKGDGKEKYRGLKNNCLELKKKNHKEEFQKELHLDDHK
LSNRELEEKYGTDIIMGLSSTRAAELLARDGPNSLTPPKQTPEIVKFLKQMVGGFSILLW
VGAFLCWIAYGIQYSSDKSASLNNVYLGCVLGLVVILTGIFAYYQEAKSTNIMSSFNKMI
PQQALVIRDSEKKTIPSEQLVVGDIVEVKGGDQIPADIRVLSSQGCRVDNSSLTGESEPQ
PRSSEFTHENPLETKNICFYSTTCLEASTSPVGTVTGMVINTGDRTIIGHIASLASGVGN
EKTPIAIEIEHFVHIVAGVAVSIGILFFIIAVSLKYQVLDSIIFLIGIIVANVPEGLLAT
VTVTLSLTAKRMAKKNCLVKNLEAVETLGSTSIICSDKTGTLTQNRMTVAHLWFDNQIFV
ADTSEDHSNQVFDQSSRTWASLSKIITLCNRAEFKPGQENVPIMKKAVIGDASETALLKF
SEVILGDVMEIRKRNRKVAEIPFNSTNKFQLSIHETDDPHGKRFLMVMKGAPERILEKCS
TIMINGEEHPLDKSTAKTFHTAYMELGGLGERVLGFCHLYLPADEFPETYSFDIDAMNFP
TSNLCFVGLLSMIDPPRSTVPDAVTKCRSAGIKVIMVTGDHPITAKAIAKSVGIISANSE
TVEDIAHRLNIAVEQVNKRDAKAAVVTGMELKDMSSEQLDEILANYQEIVFARTSPQQKL
IIVEGCQRQDAVVAVTGDGVNDSPALKKADIGIAMGIAGSDAAKNAADMVLLDDNFASIV
TGVEEGRLIFDNLKKTIAYTLTKNIAELCPFLIYIIVGLPLPIGTITILFIDLGTDIIPS
IALAYEKAESDIMNRKPRHKNKDRLVNQPLAVYSYLHIGLMQALGAFLVYFTVYAQEGFL
PRTLINLRVEWEKDYVNDLEDSYGQEWTRYQREYLEWTGYTAFFVGILVQQIADLIIRKT
RRNSIFQQGLFRNKVIWVGITSQIIIGLILSYGLGSVTALSFTMLRAQYWFVAVPHAILI
WAYDEVRKLFIRLYPGSWWDKNMYY
Download sequence
Identical sequences G3RT56
XP_004054314.1.27298 ENSGGOP00000001301 ENSGGOP00000018981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]