SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019002 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000019002
Domain Number - Region: 41-153
Classification Level Classification E-value
Superfamily E set domains 0.0203
Family Arrestin/Vps26-like 0.045
Further Details:      
 
Domain Number - Region: 190-224
Classification Level Classification E-value
Superfamily STAT 0.0824
Family STAT 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019002   Gene: ENSGGOG00000010433   Transcript: ENSGGOT00000025383
Sequence length 247
Comment pep:known_by_projection chromosome:gorGor3.1:10:81604560:81642306:1 gene:ENSGGOG00000010433 transcript:ENSGGOT00000025383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPG
KRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYES
YIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEY
NKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIVGPSTTTETETIAKYEIMDGA
PVKGNTL
Download sequence
Identical sequences ENSGGOP00000019002 ENSGGOP00000019002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]