SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019029 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019029
Domain Number 1 Region: 285-456
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-36
Family SPRY domain 0.00062
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily RING/U-box 1.48e-18
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 86-139
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000275
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019029   Gene: ENSGGOG00000028469   Transcript: ENSGGOT00000023666
Sequence length 458
Comment pep:novel chromosome:gorGor3.1:11:51975856:51982069:-1 gene:ENSGGOG00000028469 transcript:ENSGGOT00000023666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGILQVFQRELSCPICMNYFLDPVTIDCGHSFCRPCFYLNWQDMEVVAQCSKCKKTTW
QRNLNTDICLKNMASIARKASLRQFLSSEEQICGMHRETKKMFCEVDKSPLCLLCSNSQE
HRNHRHCPIEWAAEERRTSHIFFQFPQISSRNFDIEGIIDSDIDTTLCWSYFLHPPPHLV
IYFVAILSDFIKQKKIKEVSISSSNFLFIAEKASYLKQKILHLLHGYKVNQGKPERKGNI
LLVLRLKILTNLEQYEERSKYESLLLQVSEPVNPEFSAGPITGLMDRLKGFRVYLTLQHA
RANSHIFLHGDLRSMKVGCDPQDDPNITDKSECFLQWGADFFISGKFYWEFNMGHSWNWA
FGDCNNYWKEKRQNDMIDGEVGLFLLGCVKEDTHCSLFTTSPLVMQYVPRPTDTVGLFLD
CEGRTVSFVDVDRSSLIYTIPNCSFSPPLWPIICCSHF
Download sequence
Identical sequences ENSGGOP00000019029 ENSGGOP00000017732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]