SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019051 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019051
Domain Number 1 Region: 150-290
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.0000523
Family Glycerol-3-phosphate (1)-acyltransferase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019051   Gene: ENSGGOG00000024206   Transcript: ENSGGOT00000034737
Sequence length 795
Comment pep:known_by_projection chromosome:gorGor3.1:2a:93505655:93518813:-1 gene:ENSGGOG00000024206 transcript:ENSGGOT00000034737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATMLEGRCQTQPRSSPSGRETSLWSSGFGMKLEAVTPFLGKYRPFVGRCCQTCTPKSWE
SLFHRSITDLGFCNVILVKEENTRFRGWLVRRLCYFLWSLEQHIPPCQDAPQKIMESTGV
QNLLSGRVPGGTGEGQVPDLVKKEVQRILGHIQAPPRPFLVRLFSWALLRFLNCLFLNVQ
LHKGQMKMVQKAAQAGLPLVLLSTHKTLLDGILLPFMLLSQGLGVLRVAWDSRACSPALR
ALLRKLGGLFLPPEANLSLDSSEGLLARAVVQAVIEQLLVSGQPLLIFLEEPPGALGPRL
SALGQAWVGLVVQAVQVGIVPDALLVPVAVTYDLVPDAPCDIDHASAPLGLWTGALAVLR
SLWSRWGCSHRICSRVHLAQPFSLQEYIVSARSCWGGRQTLEQLLQPIVLGQCTAVPDTE
KEQEWTPITGPLLALKEEDQLLVRRLSCHVLSASVGSSAVMSTAIMATLLLFKHQKLLGE
FSWLTEEILLRGFDVGFSGQLRSLLQHSLSLLRAHVALLRIRQGDLLVVPQPGPGLTHLA
QLSAELLPVFLSEAVGACAVRGLLAGRVPPQGPWELQGILLLSQNELYRQILLLMHLLPQ
DLLLLKPCQSSYCYCQEVLDRLIQCGLLVAEETPGSRPACDTGRQRLSRKLLWKPSGDFT
DSDSDDFEEAEGRYFRLSQQSHCPDFFLFLCRLLSPLLKAFAQAAAFLRQGQLPDTELGY
TEQLFQFLQATAQEEGIFECADPKLAISAVWTFRDLGVLQQTPSPAGPRLHLSPTFASQD
NQEKLEQFIRQFICS
Download sequence
Identical sequences ENSGGOP00000019051 ENSGGOP00000019051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]