SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019094 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019094
Domain Number 1 Region: 9-555
Classification Level Classification E-value
Superfamily ARM repeat 3.58e-107
Family Clathrin adaptor core protein 0.0000000000000327
Further Details:      
 
Domain Number 2 Region: 827-940
Classification Level Classification E-value
Superfamily Subdomain of clathrin and coatomer appendage domain 1.41e-43
Family Clathrin adaptor appendage, alpha and beta chain-specific domain 0.00000245
Further Details:      
 
Domain Number 3 Region: 700-826
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 3.4e-42
Family Alpha-adaptin ear subdomain-like 0.00000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019094   Gene: ENSGGOG00000010141   Transcript: ENSGGOT00000030320
Sequence length 940
Comment pep:known_by_projection chromosome:gorGor3.1:19:47101488:47143436:1 gene:ENSGGOG00000010141 transcript:ENSGGOT00000030320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVC
KLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL
ASRNPTFMCLALHCIANVGSREMGEAFAADIPRILVAGDSMDSVKQSAALCLLRLYKASP
DLVPMGEWTARVVHLLNDQHMGVVTAAVSLITCLCKKNPDDFKTCVSLAVSRLSRIVSSA
STDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDAAVKGRLVECLETVLNKAQEPPKSKKV
QHSNAKNAILFETISLIIHYDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSE
FSHEAVKTHIDTVINALKTERDVSVRQRAADLLYAMCDRSNAKQIVSEMLRYLETADYAI
REEIVLKVAILAEKYAVDYSWYVDTILNLIRIAGDYVSEEVWYRVLQIVTNRDDVQGYAA
KTVFEALQAPACHENMVKVGGYILGEFGNLIAGDPRSSPPVQFSLLHSKFHLCSVATRAL
LLSTYIKFINLFPETKATIQGVLRAGSLMPSPALAAASPAPASLLTPSLCHSGLRRPWPP
YVVSFPVTVSQPALPSRCLSGIGCLPRLSSLVCSGIGWPSELEPPAPESPMALLADPAPA
AEACSRTQSLWAFAPPHQVPSHLTPLHASSPGPEDIGPPIPEADELLNKFVCKNNGVLFE
NQLLQIGVKSEFRQNLGRMYLFYGNKTSVQFQNFSPTVVHPGDLQAQLAVQTKRVAAQVD
GGAQVQQVLNIECLRDFLTPPLLSVRFRYGGAPQALTLKLPVTINKFFQPTEMAAQDFFQ
RWKQLSLPQQEAQKIFKANHPMDAEVTKAKLLGFGSALLDNVDPNPENFVGAGIIQTKAL
QVGCLLRLEPNAQAQMYRLTLRTSKESVSRHLCELLAQQF
Download sequence
Identical sequences ENSGGOP00000019094 ENSGGOP00000009904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]