SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019138 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019138
Domain Number 1 Region: 32-309
Classification Level Classification E-value
Superfamily L domain-like 3.33e-52
Family Ngr ectodomain-like 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000019138
Domain Number - Region: 412-445
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0193
Family Fibronectin type III 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019138   Gene: ENSGGOG00000025796   Transcript: ENSGGOT00000026649
Sequence length 578
Comment pep:known_by_projection chromosome:gorGor3.1:16:4612880:4614902:1 gene:ENSGGOG00000025796 transcript:ENSGGOT00000026649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSRVPLLLPLLLLLALGPGVQGCPSGCQCSQPQTVFCTARQGTTVPRDVPPDTVGLYVF
ENGITMLDTGSFAGLPGLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLHEITNETF
RGLRRLERLYLGKNRIRHIQPGAFDTLDRLLELKLQDNELRALPPLRLPHLLLLDLSHNS
LLALEPGILDTANVEALRLAGLGLQQLDEGLFSRLRNLHDLDVSDNQLERVPPVIRGLRG
LTRLRLAGNTRIAQLRPEDLAGLAALQELDVSNLSLQALPGDLSGLFPRLRLLAAARNPF
NCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLQLDYADFGCPATTTTATVPT
TRPVVREPTALSSSLAPTWLSPTEPATEAPSPPSTAPPTVGPVPQPQDCPPSTCLTRLPA
SLAEYTVTQLRPNATYSVCVMPLGPGRVPEGEEACGEAHTPPAVHSNHAPVTQAREGNLP
LLIAPALAAVLLAALAAVGAAYCVRRGRAMAAAAQDKGQVGPGAGPLELEGVKVPLEPGP
KATEGGGEALPSGSECEVPLMGFPGPGLQSPLHAKPYI
Download sequence
Identical sequences ENSGGOP00000019138 ENSGGOP00000019138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]