SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019141 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019141
Domain Number 1 Region: 434-678
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.18e-47
Family ATP-dependent DNA ligase catalytic domain 0.00025
Further Details:      
 
Domain Number 2 Region: 688-831
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.23e-36
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00019
Further Details:      
 
Domain Number 3 Region: 89-202
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.42e-31
Family PARP-type zinc finger 0.000000976
Further Details:      
 
Domain Number 4 Region: 925-1007
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000121
Family DNA ligase 0.000016
Further Details:      
 
Domain Number 5 Region: 258-497
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.00000000248
Family ATP-dependent DNA ligase DNA-binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019141   Gene: ENSGGOG00000025637   Transcript: ENSGGOT00000034462
Sequence length 1009
Comment pep:known_by_projection chromosome:gorGor3.1:5:49092780:49117414:-1 gene:ENSGGOG00000025637 transcript:ENSGGOT00000034462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLAFKILFPQTLRVLSRKELCLFRKRHWRDVRQFSQWSKTDLLHGHPLFLRRKPVPSFQ
GIHLRSRATYLVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIG
KVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQH
IADLSSKAAGTPKKKAVVQAKLTTTGQVTSPVKGASFVTSTNPRKFSGFSAKANNSGEAP
SSPTPKRSLSSSKCDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFH
GDVYLTVKLLLPGVIKTIYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQ
SKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDL
KMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQEVEKEPGQRRALSVQASLMTP
VQPMLAEACKSVEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAH
FKDYIPQAFPGGHSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYF
NDVSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKRVTKALDLADMITRVIQEGLEGLVLK
DVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPGS
QKWCTVTKCAGGHDDATLARLQKELDMVKISKDPSKIPSWLKVNKIYYPDFIVPDPKKAA
VWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTV
VAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPS
AMKVGEKLATKSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFV
AFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPC
Download sequence
Identical sequences G3RTL5
XP_004041980.1.27298 XP_018883179.1.27298 ENSGGOP00000019141 ENSGGOP00000019141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]