SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019168 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019168
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily EF-hand 4.57e-24
Family Parvalbumin 0.00000631
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019168   Gene: ENSGGOG00000009478   Transcript: ENSGGOT00000031181
Sequence length 110
Comment pep:known_by_projection chromosome:gorGor3.1:22:21110484:21129343:-1 gene:ENSGGOG00000009478 transcript:ENSGGOT00000031181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIE
EDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Download sequence
Identical sequences A0A2I3SE56 G3RTP2
ENSGGOP00000009256 XP_016794586.1.37143 XP_018873481.1.27298 XP_018873482.1.27298 ENSGGOP00000019168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]