SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019188 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019188
Domain Number 1 Region: 64-311
Classification Level Classification E-value
Superfamily L domain-like 1.17e-26
Family Internalin LRR domain 0.013
Further Details:      
 
Domain Number 2 Region: 383-470
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.11e-21
Family Ubiquitin-related 0.0000261
Further Details:      
 
Domain Number 3 Region: 2-77
Classification Level Classification E-value
Superfamily Cap-Gly domain 0.00000293
Family Cap-Gly domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019188   Gene: ENSGGOG00000013627   Transcript: ENSGGOT00000027571
Sequence length 470
Comment pep:known_by_projection chromosome:gorGor3.1:1:215680565:215719863:1 gene:ENSGGOG00000013627 transcript:ENSGGOT00000027571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFTRHPTGGSFIRPNKVNFGTDFLTAIKNRYVLEDGPEEDRKEQIVTIGNKPVETIGFDS
IMKQQRNYLGKLKFLSLMPCIVSLKETFWGVAGTPPHIRKVDLSKNLLSSWDEVIHIADQ
LRHLEVLNVSENKLKFPSGSVLTGTLSALKVLVLNQTGITWAEVLRCAAGCPGLEELYLE
SNNIFISERPTDVLQTVKLLDLSSNQLIDENQLYLIAHLPRLEQLILSDTGISSLHFPDA
GIGCKTSMFPSLKYLVVNDNQISQWSFFNELEKLPSLQALACLRNPLTKEDKEAETARLL
IIASIGQLKTLNKCEILPEERRRAELDYRKAFGNEWKQAGGHKDPEKNRLSEEFLTAHPR
YQFLCLKYGAPEDWELKTQQPLMLKNQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGL
LSRLLKVPVSDLLLSYESPKKPGREIELENDLKSLQFYSVENGDCLLVRW
Download sequence
Identical sequences ENSGGOP00000013299 ENSGGOP00000019188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]