SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019201 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019201
Domain Number 1 Region: 87-232,274-296,323-388
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 3.06e-18
Family Methylamine dehydrogenase, H-chain 0.083
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000019201
Domain Number - Region: 11-53
Classification Level Classification E-value
Superfamily F-box domain 0.017
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019201   Gene: ENSGGOG00000022457   Transcript: ENSGGOT00000031117
Sequence length 443
Comment pep:known_by_projection chromosome:gorGor3.1:3:49612775:49635374:1 gene:ENSGGOG00000022457 transcript:ENSGGOT00000031117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPTHQIQDPKHWNRIADSDYLSLSLQRWDCSNFTNQHLGTHTWKQFFLHQRRKELQLAL
AQPHNFVYKVTKNIAFETELAYLSGNRLTVDEQEKSIICSVSPKQELCAWDVQEGTMIWS
SPVQEFHFSNLVTLPQMHLAITMDRKKTIKVWNCQDRDALAVLPMPQPCYCMEAYLTKDG
PFLMVGDAAGDIYTFTLPGLRDISKVTAFQYGIVLLHCSPDKKWVFACGTYSRTLPQVFL
TESLLRPSEGSAPLSTFLPHKLCASACWTPKVKNRITLMSQSSTGKKTEFITFDITTKKT
GGQTVIQAYEIASFQVAAHLKCPIWMGASDGYMIVFTSGPYLLLFSITGFLLQRFEDHQA
AINNFWVDPCYVLTTSENSVHVYMWEEGGRHPYLRSCCHLENTWHDHTTDSCISSVMCDN
ASIVLTVTKVSDSSILVMYSLNT
Download sequence
Identical sequences ENSGGOP00000019201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]