SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019229 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019229
Domain Number 1 Region: 146-341
Classification Level Classification E-value
Superfamily E set domains 1.45e-77
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000376
Further Details:      
 
Domain Number 2 Region: 38-162
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.46e-23
Family Voltage-gated potassium channels 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019229   Gene: ENSGGOG00000025489   Transcript: ENSGGOT00000033991
Sequence length 393
Comment pep:known_by_projection chromosome:gorGor3.1:1:139112748:139116531:1 gene:ENSGGOG00000025489 transcript:ENSGGOT00000033991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLS
LLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETT
IGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVS
LRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLF
LVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLW
GHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEK
VEEEGAGXXXXXXXXXXXEQNGCLPPPESESKV
Download sequence
Identical sequences ENSGGOP00000019229 ENSGGOP00000019229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]