SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019251 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019251
Domain Number 1 Region: 235-456
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.49e-94
Family SMAD domain 0.00000000458
Further Details:      
 
Domain Number 2 Region: 14-132
Classification Level Classification E-value
Superfamily SMAD MH1 domain 4.05e-46
Family SMAD MH1 domain 0.00000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019251   Gene: ENSGGOG00000023966   Transcript: ENSGGOT00000025627
Sequence length 465
Comment pep:known_by_projection chromosome:gorGor3.1:5:119607277:119661724:1 gene:ENSGGOG00000023966 transcript:ENSGGOT00000025627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPG
QPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKE
VCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQP
NNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQP
MDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS
Download sequence
Identical sequences A0A091D8T3 A0A096MMR6 A0A0B8RT60 A0A0D9RLM2 A0A286ZNF5 A0A2J8VQ33 A0A2K5EXT6 A0A2K5IHK9 A0A2K5NYJ9 A0A2K5PT67 A0A2K5X4C7 A0A2K5YSA7 A0A2K6DUF7 A0A2K6EFB8 A0A2K6M333 A0A2K6QB63 D2GVL2 E2RCX7 F1MD43 F6YMS3 F7A120 G3RTX4 G5BX13 H0X0W6 K7B6A4 M3X9P2 M3YEV3 Q5R6H7 Q68DB7 Q99717 U3FCQ3
gi|47778925|ref|NP_005894.3| gi|47778929|ref|NP_001001419.1| gi|47778931|ref|NP_001001420.1| ENSPVAP00000015297 9544.ENSMMUP00000000461 9598.ENSPTRP00000046699 9600.ENSPPYP00000017676 9615.ENSCAFP00000001536 9796.ENSECAP00000016173 9823.ENSSSCP00000015232 ENSSSCP00000015232 ENSPPYP00000017676 ENSOGAP00000008590 ENSAMEP00000018952 HGL_H00000384803 ENSSSCP00000030841 ENSVPAP00000006814 ENSGGOP00000019251 ENSPPYP00000017676 ENSMPUP00000009860 ENSECAP00000016173 ENSAMEP00000018952 ENSCAFP00000001536 ENSBTAP00000029021 ENSECAP00000016173 ENSPANP00000000901 ENSBTAP00000029021 ENSOGAP00000008590 ENSP00000441954 ENSP00000446474 ENSMMUP00000000461 ENSFCAP00000023345 ENSPVAP00000015297 ENSMPUP00000009860 ENSMMUP00000000461 ENSCAFP00000001536 ENSGGOP00000019251 ENSVPAP00000006814 NP_001001419.1.87134 NP_001001419.1.92137 NP_001001420.1.87134 NP_001001420.1.92137 NP_001070575.2.59421 NP_001070575.2.76553 NP_001126544.1.23681 NP_001157360.1.31192 NP_001253244.1.72884 NP_005894.3.87134 NP_005894.3.92137 XP_001169547.1.37143 XP_001169564.1.37143 XP_001169580.1.37143 XP_002912974.1.58354 XP_003829297.1.60992 XP_003829298.1.60992 XP_004042596.1.27298 XP_004042597.1.27298 XP_004042598.1.27298 XP_004384753.1.4749 XP_004405532.1.74151 XP_004609939.1.94378 XP_004686807.2.23501 XP_004744967.1.14098 XP_004744968.1.14098 XP_004836257.1.39548 XP_005557901.1.63531 XP_005557902.1.63531 XP_005557903.1.63531 XP_005557905.1.63531 XP_005599186.1.31192 XP_005626626.1.84170 XP_005626627.1.84170 XP_005865658.1.60319 XP_005891748.1.15283 XP_006078353.1.26621 XP_006086619.1.53796 XP_006160166.1.99106 XP_006160167.1.99106 XP_006212842.1.17985 XP_006753595.1.95426 XP_006923158.1.64745 XP_006923159.1.64745 XP_006927680.1.62641 XP_007077900.1.5354 XP_008012729.1.81039 XP_008140220.1.99482 XP_008523633.1.77740 XP_008580734.1.73410 XP_008689806.1.72690 XP_008983540.1.60252 XP_009239348.1.23681 XP_009239349.1.23681 XP_010358201.1.97406 XP_010358202.1.97406 XP_010358203.1.97406 XP_010358204.1.97406 XP_010612406.1.5607 XP_010805617.1.76553 XP_010842780.1.44457 XP_010969954.1.22495 XP_010980104.1.51371 XP_011360661.1.92234 XP_011360662.1.92234 XP_011714790.1.29376 XP_011714791.1.29376 XP_011714792.1.29376 XP_011714793.1.29376 XP_011714794.1.29376 XP_011790649.1.43180 XP_011790650.1.43180 XP_011790651.1.43180 XP_011824573.1.47321 XP_011824574.1.47321 XP_011824575.1.47321 XP_011945735.1.92194 XP_011945736.1.92194 XP_011945737.1.92194 XP_011945738.1.92194 XP_011945739.1.92194 XP_011945740.1.92194 XP_012291672.1.9421 XP_012291753.1.9421 XP_012291841.1.9421 XP_012291897.1.9421 XP_012291984.1.9421 XP_012501865.1.63892 XP_012501866.1.63892 XP_012616648.1.48125 XP_012616649.1.48125 XP_012616650.1.48125 XP_012616651.1.48125 XP_012616652.1.48125 XP_012616653.1.48125 XP_012662825.1.62490 XP_014200603.1.60992 XP_014200604.1.60992 XP_014200605.1.60992 XP_014309371.1.53796 XP_014651307.1.5094 XP_014651310.1.5094 XP_014683915.1.49734 XP_014683916.1.49734 XP_014943109.1.86478 XP_014996355.1.72884 XP_014996357.1.72884 XP_014996358.1.72884 XP_014996359.1.72884 XP_015993196.1.101085 XP_015993197.1.101085 XP_016053004.1.3490 XP_016053005.1.3490 XP_016809361.1.37143 XP_016809363.1.37143 XP_016809364.1.37143 XP_016864959.1.92137 XP_017356463.1.71028 XP_017356464.1.71028 XP_017356465.1.71028 XP_017356466.1.71028 XP_017356467.1.71028 XP_017536580.1.32401 XP_017709670.1.44346 XP_017709672.1.44346 XP_017709673.1.44346 XP_017709674.1.44346 XP_017709675.1.44346 XP_017709676.1.44346 XP_017709677.1.44346 XP_017823287.1.60252 XP_018883777.1.27298 XP_019277479.1.44245 XP_019497769.1.44202 XP_019497770.1.44202 XP_019497771.1.44202 XP_019497772.1.44202 XP_019595909.1.88060 XP_019654907.1.58354 XP_019820519.1.53367 XP_020731184.1.74333 XP_020731185.1.74333 XP_020731186.1.74333 XP_020940444.1.46622 XP_020940445.1.46622 XP_020940446.1.46622 XP_021557561.1.83697 XP_021557562.1.83697 XP_538641.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]