SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019261 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019261
Domain Number 1 Region: 229-322
Classification Level Classification E-value
Superfamily EF-hand 1.2e-17
Family EF-hand modules in multidomain proteins 0.00000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019261   Gene: ENSGGOG00000006339   Transcript: ENSGGOT00000025739
Sequence length 450
Comment pep:known_by_projection chromosome:gorGor3.1:19:46194025:46216608:1 gene:ENSGGOG00000006339 transcript:ENSGGOT00000025739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPSGPRGTLLLLPLLLPLLFRAVLAVPLERGAPNKEETPATESPDTGLYYHRYLQEVID
VLETDGHFREKLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEVSRLRMLLKAKMD
AEQDPNVQVDHLNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYE
MLKEHERRRYLESLGEEQRKEAERKLEEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDP
NRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHV
MKNVDTNQDRLVTLEEFLASTQRKDFGDTGEGWETVEMHPAYTEEELRRFEEELAAREAE
LNAKAQRLSQETEALGRSQGRLEAQKRELQQAVLHMGHKAPAAHPEGQLKFHPDTDDVPV
PAPAGDQKEVDTSEKKLLERLPEVEVPQHL
Download sequence
Identical sequences ENSGGOP00000019261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]