SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019292 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019292
Domain Number 1 Region: 346-697
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.28e-84
Family Protein kinases, catalytic subunit 0.00000182
Further Details:      
 
Domain Number 2 Region: 161-261
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 1.31e-44
Family MAST3 pre-PK domain-like 0.0000136
Further Details:      
 
Domain Number 3 Region: 932-1031
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-19
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019292   Gene: ENSGGOG00000003390   Transcript: ENSGGOT00000024583
Sequence length 1544
Comment pep:known_by_projection chromosome:gorGor3.1:19:13088671:13123122:1 gene:ENSGGOG00000003390 transcript:ENSGGOT00000024583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSCRTSNRKSLILTSTSPTLPRPHSPLPGHLGSSPLDSPRNFSPNTPAHFSFASSRRADG
RRWSLASLPSSGYGTNTPSSTVSSSCSSQERLHQLPYQPTVDELHFLSKHFGSTESITDE
DGGRRSPAVRPRSRSLSPGRSPSSYDNEIVMMNHVYKERFPKATAQMEEKLRDFTRAYEP
DSVLPLADGVLSFIHHQIIELARDCLTKSRDGLITTVYFYELQENLEKLLQDAYERSESL
EVAFVTQLVKKLLIIISRPARLLECLEFNPEEFYHLLEAAEGHAKEGHLVKTDIPRYIIR
QLGLTRDPFPDVVHLEEQDSGGSNTPEQDDLPEGRSSKAKKPPGENDFDTIKLISNGAYG
AVYLVRHRDTRQRFAMKKINKQNLILRNQIQQAFVERDILTFAENPFVVGMFCSFETRRH
LCMVMEYVEGGDCATLLKNIGALPVEMARMYFAETVLALEYLHNYGIVHRDLKPDNLLIT
SMGHIKLTDFGLSKMGLMSLTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQGYGK
PVDWWAMGIILYEFLVGCVPFFGDTPEELFGQVISDDILWPEGDEALPTEAQLLISSLLQ
TNPLVRLGAGGAFEVKQHSFFRDLDWTGLLRQKAEFIPHLESEDDTSYFDTRSDRYHHVN
SYDEDDTTEEEPVEIRQFSSCSPRFSKVYSSMEQLSQHEPKTPVAAAGSSKREPSTKGPE
EKVAGKREGLGGLTLREKTWRGGSPEIKRFSASEASFLEGEASPPLGARRRFSALLEPSR
FSAPQEDEDEARLRRPPRPSSDPAGSLDARAPKDETQGEGTSSAGDSEATDRPRPGDLCP
PSKDGDASGPRATNDLVLRRARHQQMSGDAAVEKRPSRTGGKVIKSASATALSVMIPAVD
PHGSSPLASPMSPRSLSSNPSSRDSSPSRDYSPAVSGLRSPITIQRSGKKYGFTLRAIRV
YMGDTDVYSVHHIVWHVEEGGPAQEAGLCAGDLITHVNGEPVHGMVHPEVVELILKSGNK
VAVTTTPFENTSIRIGPARRSSYKAKMARRNKRPSAKEGQESKKRSSLFRKITKQSNLLH
TSRSLSSLNRSLSSSDSLPGSPTHGLPARSPTHSYRSTPDSAYLGASSQSSSPASSTPNS
PASSASHHIRPSTLHGLSPKLHRQYRSARCKSAGNIPLSPLAHTPSPTQASPPPLPGHTV
GSSHTTQSFPAKLHSSPPVVRPRPKSAEPPRSPLLKRVQSAEKLGASLSADKKGALRKHS
LEVGHPDFRKDFHGELALHSLAESDGETPPVEGLGAPRQVAVRRLGRQESPLSLGADPLL
PEGASRPPVSSKEKESPGGAEACTPPRATTPGGRTLERDVGCTRHQSVQTEDGTGGMARA
VAKAALSPVQEHETGRRSSSGEAGTPLVPIVVEPTRPGAKAVVPQPLGADSKGLQELAPL
APSVPEAPRGRERWVLEVVEERTTLSGPRSKPASPKLSPEPQTPSLAPAKCSAPSSAVTP
VPPASLLGSGTKPQVGLTSRCPAEAVPPAGLTKKGVSSPAPPGP
Download sequence
Identical sequences ENSGGOP00000019292 ENSGGOP00000019292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]