SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019298 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000019298
Domain Number - Region: 441-446
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00942
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019298   Gene: ENSGGOG00000022052   Transcript: ENSGGOT00000031458
Sequence length 708
Comment pep:known_by_projection chromosome:gorGor3.1:1:68794828:68904094:1 gene:ENSGGOG00000022052 transcript:ENSGGOT00000031458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPTGLKKRTRKAFGIRKKEKDTDSTGSPDRDGIQGKKKTQKTQLLLTSCFWLRALSLTLS
QQPSPHEPPYNSKAECAREGGKKVSKKSNGAPNGFYAEIDWERYNSPELDEEGYSIRPEE
PGYILKGKHFYSSSESEEEEESHKKFNIKIKPLQSKDILKNAATVDELKASIGNIALSPS
PVRKSPRRSPGAIKRNLSSEEVARPRRSTPTPELISKKPADDTTALAPLFGPPLESAFDE
QKTEVLLDQPEIWGSGQPINPSMESPKLTRPFPTGTPPPLPPKNVPATPPRTGSPLTIGP
GNDQSATEVKIEKLPSINDLDSIFGPVLSPKSVAVNAEEKWVHFSDTSPEHVTPELTPRE
KVVSPPATPDNPADSPAPGPLGPPGPTGPPGPPGPPRNVPSPLNLEEVQKKVAEQTFIKD
DYLETISSPKDFGLGQRATPPPPPPPTYRTVVSSPGPGSGPGPGTTSGASSPARPATPLV
PCRSTTPPPPPPRPPSRPKLPPGKPGVGDVSRPFSPPIHSSSPPPIAPLARAESTSSISS
TNSLSAATTPTVENEQPSLVWFDRGKFYLTFEGSSRGPSPLTMGAQDTLPVAAAFTETVN
AYFKGADPSKCIVKITGEMVLSFPAGITRHFANNPSPAALTFRVINFSRLEHVLPNPQLL
CCDNTQNDANTKEFWVNMPNLMTHLKKVSEQKPQATYYNVDMLKYQVS
Download sequence
Identical sequences ENSGGOP00000019298 ENSGGOP00000019298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]