SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019301 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019301
Domain Number 1 Region: 85-380
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.43e-72
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000253
Further Details:      
 
Domain Number 2 Region: 482-552
Classification Level Classification E-value
Superfamily DUSP-like 0.0000000000942
Family DUSP, domain in ubiquitin-specific proteases 0.012
Further Details:      
 
Domain Number 3 Region: 945-1000
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000004
Family Ubiquitin-related 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000019301
Domain Number - Region: 735-809
Classification Level Classification E-value
Superfamily DUSP-like 0.00288
Family DUSP, domain in ubiquitin-specific proteases 0.011
Further Details:      
 
Domain Number - Region: 645-685
Classification Level Classification E-value
Superfamily DUSP-like 0.0144
Family DUSP, domain in ubiquitin-specific proteases 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019301   Gene: ENSGGOG00000004749   Transcript: ENSGGOT00000027638
Sequence length 1033
Comment pep:known_by_projection chromosome:gorGor3.1:1:22389949:22495402:-1 gene:ENSGGOG00000004749 transcript:ENSGGOT00000027638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGE
HIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLC
PSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQ
DAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELE
LNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFV
FDSLPFLKKKLTIFSGFLKNNDFLPFSPGGSYVYELSAVLIHRGVSAYSGHYIAHVKDPQ
SGEWYKFNDEDIEKMEGKKLQLGIEEDLGKTFKFQVKILSTGIGNCPRAQTLFWKSNTQH
TWRSHSFRQRIAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQRLPAG
AEPYEFVSLEWLQKWLDESTPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYSRY
GGGPRLTVKALCKECVVERCRILRLKNQLNEDYKTVNNLLKAAVKGNDGFWVGKSSLRSW
RQLALEQLDEQDGDAEQSNGKMNGSTLNKDESKEERKEEEELNFNEDILCPHGELCISEN
ERRLVSKEAWSKLQQYFPKAPEFPSYKECCSQCKILEREGEENEALHKMIANEQKTSLPN
LFQDKNRPCLSNWPEDTDVLYIVSQFFVEEWRKFVRKPTRCSPVSSVGNSALLCPHGGLM
FTFASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVNPSETQYISEPKLCP
ECREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGE
KDPDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELKIQI
MHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQVCM
PEEGFKGTGLLGH
Download sequence
Identical sequences ENSGGOP00000019301 ENSGGOP00000004659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]