SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019313 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019313
Domain Number 1 Region: 4-55
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.57e-17
Family Ribosomal protein L24e 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019313   Gene: ENSGGOG00000024311   Transcript: ENSGGOT00000022298
Sequence length 163
Comment pep:novel chromosome:gorGor3.1:19:12303434:12304639:1 gene:ENSGGOG00000024311 transcript:ENSGGOT00000022298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHIEKCYFCLGPIYPGHGIMFFCNNCKVFRFCKSKCHKNFKKKCNPHKVRWTKAFQKATS
KELTVDNSFEFEKHRNEPIKYQQELWNKTIDAMKRVEEIKQKWQAKFIMNGLKKNKELQK
VQDFREVKQNIHLILAPFAGKEKQLEEKMVTQTSNDLEAEESH
Download sequence
Identical sequences ENSGGOP00000019313 ENSGGOP00000019313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]