SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019318 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019318
Domain Number 1 Region: 149-233
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.0000000000977
Family HSP20 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019318   Gene: ENSGGOG00000007936   Transcript: ENSGGOT00000023509
Sequence length 245
Comment pep:known_by_projection chromosome:gorGor3.1:1:16503696:16507891:-1 gene:ENSGGOG00000007936 transcript:ENSGGOT00000023509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGCELSPLGLRVGLSAGPAHGRRFPAPSGPWRGLNLASRQGAGPKPRDSRPYKAAAVRA
WHARPEACTHTLSCPALARLGRARRRPWMSHRTSSTFRAERSFPASRALPAQDPPMEKAL
SMFSDDFGSFMRPHSEPLAFPARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHI
EVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIRARRHPHTEHVQQTFR
TEIKI
Download sequence
Identical sequences ENSGGOP00000019318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]