SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019326 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019326
Domain Number 1 Region: 255-516
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-56
Family Nuclear receptor ligand-binding domain 0.0000000164
Further Details:      
 
Domain Number 2 Region: 183-260
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.69e-28
Family Nuclear receptor 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019326   Gene: ENSGGOG00000028179   Transcript: ENSGGOT00000025401
Sequence length 518
Comment pep:known_by_projection chromosome:gorGor3.1:9:81957957:81997374:1 gene:ENSGGOG00000028179 transcript:ENSGGOT00000025401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHDSIRFGNVDMPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITA
TATTSLPSISTFVEGYSSNYELKPSCVYQMQRPLIKVEEGRAPSYHHHHHHHHHHPLGAA
AAAGSQAAALEGHPYGLPLAKRAAPLAFPPLGLTPSPTASSLLGESHSLPSPPNRSSSSG
EGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCR
FQKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTD
STPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTL
LIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLN
LDIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALV
ELRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
Download sequence
Identical sequences ENSGGOP00000019326 ENSGGOP00000019326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]