SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019335 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019335
Domain Number 1 Region: 18-46,89-163
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.58e-21
Family Voltage-gated potassium channels 0.0057
Further Details:      
 
Domain Number 2 Region: 194-301
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.66e-18
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019335   Gene: ENSGGOG00000027281   Transcript: ENSGGOT00000023726
Sequence length 408
Comment pep:known_by_projection chromosome:gorGor3.1:14:71646675:71785423:1 gene:ENSGGOG00000027281 transcript:ENSGGOT00000023726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRGFSWGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANF
SRGHNLSRDELRGFLRHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPAT
VGGKIFLIFYGLVGCSSTILFFNLFLERLITIIAYIMKSCHQRQLRRRGALPQESLKDAG
QCEGDSLAGWKPSVYYVMLILCTASILISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGF
GDLVSSQNAHYESQGLYRFANFVFILMGVCCIYSLFNVISILIKQSLNWILRKMDSGCCP
QCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRRLSGEMISMKDLLAANKASL
AILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR
Download sequence
Identical sequences G3QYK5
ENSGGOP00000019335 ENSGGOP00000019335 XP_004055610.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]