SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019354 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019354
Domain Number 1 Region: 54-184,215-332
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.43e-39
Family FAD/NAD-linked reductases, N-terminal and central domains 0.06
Further Details:      
 
Domain Number 2 Region: 622-696
Classification Level Classification E-value
Superfamily EF-hand 2.68e-17
Family Calmodulin-like 0.02
Further Details:      
 
Domain Number 3 Region: 313-407
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000706
Family D-aminoacid oxidase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019354   Gene: ENSGGOG00000022735   Transcript: ENSGGOT00000033620
Sequence length 730
Comment pep:known_by_projection chromosome:gorGor3.1:2b:43948209:44100509:1 gene:ENSGGOG00000022735 transcript:ENSGGOT00000033620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQKAVKGTILVGGGALATVLGLSQFAHYRRKQMNLAYVKAADCISEPVNREPPSREAQ
LLTLQNTSEFDILVIGGGATGSGCALDAVTRGYTGLKTALVERDDFSSGTSSRSTKLIHG
GVRYLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWVGI
KLYDLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAA
RYGAATANYMEVVSLLKKTDPQTGKVRVSGARCKDVLTGQEFDVRAKCVINATGPFTDSV
RKMDDKDAAAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDT
PTDVTHHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSIS
RNHVVDISESGLITIAGGKWTTYRSMAEDTINAAVKTHNLKAGPSRTVGLFLQGGKDWSP
TLYIRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEV
KYGIKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDYKKQEQLETARK
FLYYEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESINV
QMDENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVP
IPVDRSCGGL
Download sequence
Identical sequences ENSGGOP00000019354 ENSGGOP00000019354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]