SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019370 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019370
Domain Number 1 Region: 64-148
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000746
Family HLH, helix-loop-helix DNA-binding domain 0.0000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019370   Gene: ENSGGOG00000013614   Transcript: ENSGGOT00000027998
Sequence length 228
Comment pep:known_by_projection chromosome:gorGor3.1:10:124064037:124128445:1 gene:ENSGGOG00000013614 transcript:ENSGGOT00000027998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERVRMINVQRLLEAAEFLERRERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSG
SSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLE
EAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVD
VESTEFSHGEVDNISTTSISDIDDHSSLPSIGSDEGYSSASVKLSFTS
Download sequence
Identical sequences A0A096P6J9 A0A2J8W784 A0A2K5I0X7 A0A2K5NYD5 A0A2K5UQN2 A0A2K5ZW63 A0A2K6CEE6 H9EN03 K7AGE9
ENSGGOP00000019370 ENSMMUP00000018852 XP_005566463.1.63531 XP_007962262.1.81039 XP_011713941.1.29376 XP_011783278.1.43180 XP_011822939.1.47321 XP_011898259.1.92194 XP_015003623.1.72884 XP_016774799.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]