SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019376 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019376
Domain Number 1 Region: 85-114
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000304
Family LIM domain 0.01
Further Details:      
 
Domain Number 2 Region: 49-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000556
Family LIM domain 0.0034
Further Details:      
 
Domain Number 3 Region: 19-49
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000382
Family LIM domain 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000019376
Domain Number - Region: 115-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00489
Family LIM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019376   Gene: ENSGGOG00000025445   Transcript: ENSGGOT00000025117
Sequence length 156
Comment pep:known_by_projection chromosome:gorGor3.1:12:16753052:16809209:-1 gene:ENSGGOG00000025445 transcript:ENSGGOT00000025117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKKEKSFGIQMLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGE
VGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCN
QRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR
Download sequence
Identical sequences A0A096N501 A0A0Q3RHT8 A0A1U7UAP6 A0A287BRD0 A0A2I3FUI6 A0A2I3TRR5 A0A2J8T1N5 A0A2K5DM39 A0A2K5INU0 A0A2K5LAY6 A0A2K6A388 A0A2K6D8F7 A0A2K6EM37 A0A2K6K030 A0A2K6P7G4 A0A2K6S3Z9 E2RHK8 F6YLE0 F7D724 F7FGH8 G3RU99 G7PJZ1 I3M6V6 S7PJ90 U3K4X0 W5QHA8
ENSMMUP00000040147 ENSMODP00000022310 ENSDNOP00000009710 ENSEEUP00000005007 NP_001230540.1.87134 NP_001230540.1.92137 XP_002196668.1.42559 XP_002712669.2.1745 XP_002752234.1.60252 XP_003265608.1.23891 XP_003433617.1.84170 XP_003816579.1.60992 XP_003934624.1.74449 XP_004006861.1.66739 XP_004052860.1.27298 XP_004390867.1.4749 XP_004407023.1.74151 XP_004435472.2.5094 XP_004460353.1.11602 XP_004611345.1.94378 XP_004713831.1.18182 XP_004755806.1.14098 XP_005040448.1.66865 XP_005207038.1.76553 XP_005425362.1.5688 XP_005481913.1.73095 XP_005527021.1.90289 XP_005570314.1.63531 XP_005866826.1.60319 XP_005907499.1.15283 XP_006080629.1.26621 XP_006084361.1.53796 XP_006167381.1.99106 XP_006199966.1.17985 XP_006866083.1.41390 XP_006888500.1.29581 XP_006912723.1.64745 XP_007100461.1.24612 XP_007194871.1.59432 XP_007503657.1.35504 XP_007942637.1.48129 XP_007965973.1.81039 XP_008062961.1.4292 XP_008138680.1.99482 XP_008831578.1.79516 XP_008933018.1.51550 XP_008933018.1.96775 XP_009093408.1.15306 XP_009245793.1.23681 XP_009568936.1.62272 XP_009670230.1.43253 XP_009901100.1.92783 XP_010209167.1.23224 XP_010224137.1.20684 XP_010374037.1.97406 XP_010402484.1.2935 XP_010564416.1.12557 XP_010857049.1.44457 XP_010944786.1.22495 XP_010987155.1.51371 XP_011371241.1.92234 XP_011739449.1.29376 XP_011809958.1.43180 XP_011830828.1.47321 XP_011913823.1.92194 XP_012006212.1.54773 XP_012303106.1.9421 XP_012518242.1.63892 XP_012631268.1.48125 XP_013802735.1.3284 XP_014421047.1.101512 XP_014725415.1.99236 XP_014917247.1.86478 XP_015006590.1.72884 XP_015393225.1.5354 XP_015484583.1.82291 XP_015723340.1.68032 XP_016015249.1.101085 XP_017384285.1.71028 XP_017515157.1.32401 XP_017679486.1.3805 XP_017729318.1.44346 XP_017903910.1.57651 XP_019307646.1.44245 XP_019345105.1.47583 XP_019371143.1.87953 XP_019400030.1.79039 XP_019498869.1.44202 XP_019600337.1.88060 XP_019654696.1.58354 XP_019690145.1.62641 XP_020664221.1.8467 XP_020735297.1.74333 XP_020850025.1.61212 XP_021246534.1.32913 XP_021390824.1.53032 XP_021546285.1.83697 XP_416410.3.86415 XP_520773.3.37143 ENSMODP00000022310 ENSEEUP00000005007 13616.ENSMODP00000022310 9361.ENSDNOP00000009710 9544.ENSMMUP00000040147 9598.ENSPTRP00000008089 9600.ENSPPYP00000004953 ENSMMUP00000019684 ENSP00000261169 ENSOARP00000022108 ENSCJAP00000050752 ENSCAFP00000018587 ENSDNOP00000023193 ENSP00000261169 ENSGGOP00000019376 ENSGALP00000009582 ENSFALP00000010074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]