SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019379 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019379
Domain Number 1 Region: 347-385
Classification Level Classification E-value
Superfamily SAP domain 0.000000000311
Family SAP domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019379   Gene: ENSGGOG00000015180   Transcript: ENSGGOT00000025637
Sequence length 925
Comment pep:known_by_projection chromosome:gorGor3.1:22:24742449:24966295:-1 gene:ENSGGOG00000015180 transcript:ENSGGOT00000025637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPLKSPAAFHEQRRSLERARTEDYLKRKIRSRPERSELVRMHILEGAETSAEPSLQAKQ
LKLKRARLADDLNEKIAQRPGPMELVEKNILPVESSLKEAIIVGQVNYPKVADSSSFDED
SSDALSPEQPASHESQGSVPSPLEARVSEPLPSATSASPTQVVSQLPMGRDSREMLFLAE
QPPLPPPPLLPPSLTNGTTVPTAKSTPTLIKQSQPKSASEKSQRSKKAKELKPKVKKLKY
HQYIPPDQKQDRGAPPMDSSYAKILQQQQLFLQLQILNQQQQQHHNYQAILPAPPKSAGE
ALGSSGTPPVRSLSTTNSSSSSGAPGPCGLARQNSTSLTGKPGALPANLDDMKVAELKQE
LKLRSLPVSGTKTELIERLRAYQDQISPVPGAPKAPATTSILHKAGEVVVAFPAARLSTG
PALVAAGLAPTEVVVATVTSNGVVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDTFGE
MVTSPLTQLTLQASPLQILVKEEGPRAGSCCLSPGGRAELEGRDKDQMLQEKDKQIEALT
RMLRQKQQLVERLKLQLEQEKRAQHGTPVKQENSFSSCQLSRQPLGPAHPFNPSLAAPAT
NHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPGLIKGIAPPTLITDSTGTH
LVLTVTNKNADSPGLSSGSPQQPSSQPGSPAPAPSAQMDLEHPLQPLFGTPTSLLKKEPP
GYEEAMNQQPKQQENGSSSQQMDDLFDILIQSGEISADFKEPPSLPGKEKPSPKTVCGSP
LAAQPSPSAELPQAAPPPPGSPSLPGRLEDFLESSTGLPLLTSGHDGPEPLSLIDDLHSQ
MLSSTAILDHPPSPMDTSELHFVPEPSSTMGLDLADGHLDSMDWLELSSGGPVLSLAPLS
TTAPSLFSTDFLDGHDLQLHWDSCL
Download sequence
Identical sequences ENSGGOP00000019379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]