SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019397 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019397
Domain Number 1 Region: 91-171
Classification Level Classification E-value
Superfamily Ribosomal protein S18 0.000000000034
Family Ribosomal protein S18 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019397   Gene: ENSGGOG00000011317   Transcript: ENSGGOT00000034578
Sequence length 259
Comment pep:known_by_projection chromosome:gorGor3.1:6:31564661:31573093:1 gene:ENSGGOG00000011317 transcript:ENSGGOT00000034578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLE
SEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRVS
GRANIQRFVCIHYKQDILLPTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFST
SHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLREESGPPPESMPKMP
PRTPAEASSTGQTGPQSAL
Download sequence
Identical sequences ENSGGOP00000019397 ENSGGOP00000011033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]